(data stored in ACNUC7421 zone)

EMBL: CP001630.PE211

CP001630.PE211       Location/Qualifiers
FT   CDS             239881..240186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34185"
FT                   /db_xref="GOA:C6WF53"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34185.1"
FT                   /translation="MSRWRSTTRASSGSYTAARVISGVGVVFAVIEVLFILMVLLGAES
FT                   TNAFFQFISQLANPLALFFPGLFQFSDESVELIVNYGLAAVFWLVVTSLLARLIAR"
     MSRWRSTTRA SSGSYTAARV ISGVGVVFAV IEVLFILMVL LGAESTNAFF QFISQLANPL        60
     ALFFPGLFQF SDESVELIVN YGLAAVFWLV VTSLLARLIA R                           101
//

If you have problems or comments...

PBIL Back to PBIL home page