(data stored in ACNUC7421 zone)

EMBL: CP001630.PE212

CP001630.PE212       Location/Qualifiers
FT   CDS             complement(240214..240846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0215"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: ank:AnaeK_1659
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34186"
FT                   /db_xref="GOA:C6WF54"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF54"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACU34186.1"
FT                   /translation="MARNGAEQGGSGQGGLELAGVIADRWSPRAFDAGAALGEDEARSL
FT                   FEAARWAASHGNTQPARFLLARRGEPAHERVFAALSRGNRTWAGSASALVVAALATSDA
FT                   KGPLPNAEFGLGLAVQNLVLQAVQLGLVAHQMGGFDPEALREALSIPGDVRPVVVIAVG
FT                   REGDGSDLPEDLRAKDERPRKRKPLAETVFSGKWGEAAFTPETPATS"
     MARNGAEQGG SGQGGLELAG VIADRWSPRA FDAGAALGED EARSLFEAAR WAASHGNTQP        60
     ARFLLARRGE PAHERVFAAL SRGNRTWAGS ASALVVAALA TSDAKGPLPN AEFGLGLAVQ       120
     NLVLQAVQLG LVAHQMGGFD PEALREALSI PGDVRPVVVI AVGREGDGSD LPEDLRAKDE       180
     RPRKRKPLAE TVFSGKWGEA AFTPETPATS                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page