(data stored in ACNUC7421 zone)

EMBL: CP001630.PE213

CP001630.PE213       Location/Qualifiers
FT   CDS             complement(240873..242096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5370 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34187"
FT                   /db_xref="GOA:C6WF55"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF55"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34187.1"
FT                   /translation="MAGTTLVAVPTVDAGPDSPERAPSTRGPLAGLAEHRFAPVIAPGA
FT                   LYLLVRLLGVLVLALMSDHWDKDVAKVLTSWDGQWFLGIAQGGYGGVTPALVDAFGRRS
FT                   AETPLAFFPGYPLLVGWVGALPGVSAVGAAFSVSLVSGVFCAYGLHRLGRSVRGGSERA
FT                   GLVLVVLFAASPMAVVLSMAYSEALFCALAAWSLVGVVERRWVLAGLCAAGAGLVRPTA
FT                   GALVLAVGLAALVAVWQRRDGLRPWAGGVLAPLGMLGYLGFVAVRTGQLDGWFAVQQRG
FT                   WGSKFDGGAATWRFTWEILANPRSVLELVTVWLLLGALALVVVCVRRRLEWPLVVYAVG
FT                   VIVMDLGSNGLMNSKARLLLPAFALLLPIALSLAKRRTGAVVSVLAGVAVFGAWFGAYS
FT                   ITAWQYAI"
     MAGTTLVAVP TVDAGPDSPE RAPSTRGPLA GLAEHRFAPV IAPGALYLLV RLLGVLVLAL        60
     MSDHWDKDVA KVLTSWDGQW FLGIAQGGYG GVTPALVDAF GRRSAETPLA FFPGYPLLVG       120
     WVGALPGVSA VGAAFSVSLV SGVFCAYGLH RLGRSVRGGS ERAGLVLVVL FAASPMAVVL       180
     SMAYSEALFC ALAAWSLVGV VERRWVLAGL CAAGAGLVRP TAGALVLAVG LAALVAVWQR       240
     RDGLRPWAGG VLAPLGMLGY LGFVAVRTGQ LDGWFAVQQR GWGSKFDGGA ATWRFTWEIL       300
     ANPRSVLELV TVWLLLGALA LVVVCVRRRL EWPLVVYAVG VIVMDLGSNG LMNSKARLLL       360
     PAFALLLPIA LSLAKRRTGA VVSVLAGVAV FGAWFGAYSI TAWQYAI                     407
//

If you have problems or comments...

PBIL Back to PBIL home page