(data stored in ACNUC7421 zone)

EMBL: CP001630.PE214

CP001630.PE214       Location/Qualifiers
FT   CDS             242173..243438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0217"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: tgr:Tgr7_1290 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34188"
FT                   /db_xref="GOA:C6WF56"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF56"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACU34188.1"
FT                   /translation="MALVVQKYGGSSVESAERIKRVAERIVATRKAGNDVVVAVSAMGD
FT                   STDELLDLAHQVAPVPPGRELDMLLTAGERISMSLLAMAISSLGASARSYTGSQAGVIT
FT                   TEVHGKARIIDVTPSRIQDALAEGHIAIVAGFQGVSQGTKEITTLGRGGTDTTAVALAA
FT                   ALKADVCEIYTDVDGVFTADPRIVPNAKRLESISYEEMLEMAACGAKVLMLRCVEYARR
FT                   YNVPVHVRSSFSNKPGTTVSGSVEDLPVEQAMITGVAHDRSEAKVTVTAVPDHPGVAAR
FT                   IFRVVAEAEIDIDMVVQNVSQAVSGRTDVTFTLPKDDGPRAVAALEKARGEIGFEKVIY
FT                   DDHVGKVSLIGAGMRSHPGVTATFCEALASAGVNIEIISTSEIRISVICRDTQLDDAVR
FT                   ALHDVFELGGDEEAVVYGGSGR"
     MALVVQKYGG SSVESAERIK RVAERIVATR KAGNDVVVAV SAMGDSTDEL LDLAHQVAPV        60
     PPGRELDMLL TAGERISMSL LAMAISSLGA SARSYTGSQA GVITTEVHGK ARIIDVTPSR       120
     IQDALAEGHI AIVAGFQGVS QGTKEITTLG RGGTDTTAVA LAAALKADVC EIYTDVDGVF       180
     TADPRIVPNA KRLESISYEE MLEMAACGAK VLMLRCVEYA RRYNVPVHVR SSFSNKPGTT       240
     VSGSVEDLPV EQAMITGVAH DRSEAKVTVT AVPDHPGVAA RIFRVVAEAE IDIDMVVQNV       300
     SQAVSGRTDV TFTLPKDDGP RAVAALEKAR GEIGFEKVIY DDHVGKVSLI GAGMRSHPGV       360
     TATFCEALAS AGVNIEIIST SEIRISVICR DTQLDDAVRA LHDVFELGGD EEAVVYGGSG       420
     R                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page