(data stored in ACNUC7421 zone)

EMBL: CP001630.PE215

CP001630.PE215       Location/Qualifiers
FT   CDS             243435..244502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0218"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: bcb:BCB4264_A3899 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase
FT                   dimerization region; Semialdehyde dehydrogenase NAD -
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34189"
FT                   /db_xref="GOA:C6WF57"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF57"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ACU34189.1"
FT                   /translation="MSGGPVLALVGATGAVGTVMISIINNRETVPWGEIRLIASARSAG
FT                   KKIHVRGEDLTVVELTPEAFDGVDVAMFDVPDEVSARWAPIAAARGAVAVDNSGAFRMD
FT                   DEVPLVVPEVNADRIGDRPKGIIANPNCTTLSMMAAIGALHREFGLRELVVASYQAASG
FT                   GGQAAIDRLRAEVEAVSGKQVGERAGDVREALDAAGLPVSDSPFPAPLALNVVPWAGSL
FT                   KDDGWTSEELKVRNESRKILGIPDLKVSATCVRVPVVTTHSLAVHAVFERPVTVGQAHK
FT                   IFEEQPSVVLVDEPEAQRFPTPADVVGGDPTYVGRVRQALDFPNALDFFVCGDNLRKGA
FT                   ALNTYEIAEELAGRL"
     MSGGPVLALV GATGAVGTVM ISIINNRETV PWGEIRLIAS ARSAGKKIHV RGEDLTVVEL        60
     TPEAFDGVDV AMFDVPDEVS ARWAPIAAAR GAVAVDNSGA FRMDDEVPLV VPEVNADRIG       120
     DRPKGIIANP NCTTLSMMAA IGALHREFGL RELVVASYQA ASGGGQAAID RLRAEVEAVS       180
     GKQVGERAGD VREALDAAGL PVSDSPFPAP LALNVVPWAG SLKDDGWTSE ELKVRNESRK       240
     ILGIPDLKVS ATCVRVPVVT THSLAVHAVF ERPVTVGQAH KIFEEQPSVV LVDEPEAQRF       300
     PTPADVVGGD PTYVGRVRQA LDFPNALDFF VCGDNLRKGA ALNTYEIAEE LAGRL            355
//

If you have problems or comments...

PBIL Back to PBIL home page