(data stored in ACNUC7421 zone)

EMBL: CP001630.PE216

CP001630.PE216       Location/Qualifiers
FT   CDS             244506..245936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0219"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG:
FT                   bcb:BCB4264_A2253 gluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34190"
FT                   /db_xref="GOA:C6WF58"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF58"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ACU34190.1"
FT                   /translation="MRDEGVVLAVDLGTTATKVVAVDLRARVLRSTERGYPMRTTPSGE
FT                   ATQDPDEVLAAALAAVSEVALACPEGVRALVLTGALHTLLGLDESGRPVTPSLSWADRR
FT                   AVEQVARLRAGDGVALHRATGTPVHTMSPLVKLRWFADHRVEAHRWCGLKDYVFAHLTG
FT                   VLATEHSSGSATGLMDLRALDWHPEALAHARVRADQLPELHAPTDSFPLRAAVDGVAPG
FT                   TPVVLGGGDGPLANLGVGAIVPGVAALSLGTSGALRVVSPEPAVDERGRVFCYAIGDGL
FT                   WTVGGAVSNGGVVASWAAESFGADVVELLDEAARVPVGASGVTALPYLLGERAPWWDAD
FT                   ATSAVVGLRREHGRAELTRALVEGVAQQLALVLDAVRSVAEVRLVRATGGALRHELWAS
FT                   VLCAALDVPLEITEDTGGSAVGAALLAWRSLGGLDSLAGTADLVFPERRYEPDPVAAAH
FT                   YAAARPGVERLYEALREL"
     MRDEGVVLAV DLGTTATKVV AVDLRARVLR STERGYPMRT TPSGEATQDP DEVLAAALAA        60
     VSEVALACPE GVRALVLTGA LHTLLGLDES GRPVTPSLSW ADRRAVEQVA RLRAGDGVAL       120
     HRATGTPVHT MSPLVKLRWF ADHRVEAHRW CGLKDYVFAH LTGVLATEHS SGSATGLMDL       180
     RALDWHPEAL AHARVRADQL PELHAPTDSF PLRAAVDGVA PGTPVVLGGG DGPLANLGVG       240
     AIVPGVAALS LGTSGALRVV SPEPAVDERG RVFCYAIGDG LWTVGGAVSN GGVVASWAAE       300
     SFGADVVELL DEAARVPVGA SGVTALPYLL GERAPWWDAD ATSAVVGLRR EHGRAELTRA       360
     LVEGVAQQLA LVLDAVRSVA EVRLVRATGG ALRHELWASV LCAALDVPLE ITEDTGGSAV       420
     GAALLAWRSL GGLDSLAGTA DLVFPERRYE PDPVAAAHYA AARPGVERLY EALREL           476
//

If you have problems or comments...

PBIL Back to PBIL home page