(data stored in ACNUC7421 zone)

EMBL: CP001630.PE218

CP001630.PE218       Location/Qualifiers
FT   CDS             complement(246436..247614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0221"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ppg:PputGB1_3286 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34192"
FT                   /db_xref="GOA:C6WF60"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF60"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34192.1"
FT                   /translation="MSLNAYRSVLRTPQVVPTMLVVLLARIPITGVGMTLTMHVLLALD
FT                   HGYAAAGLVGMAATAGSAIGSPLLGRMLDRRGLRAVVGVSIVVEALFWLTAPLLSYPAL
FT                   LVTAFLSSLAALPVMSLGRQALTALVPESGRRTALALDSMAVELAFMAGPALGVFLGTH
FT                   WTGRPAMWVIGTAVVLSGLLLWVVDPPLRAGGAAPGGQAPRGWLDRRLVGVLISAGGAT
FT                   FLLTGVELATVAQMRAQGLTEWTGAAIVVMCAASLVGGFWYGGFERPVPVWALMAGMGV
FT                   LTLPLVLAGGSPWLLGPALALSSFLCAPTLTATGEAITTMAPEGARGTALGLQGAAFTL
FT                   GSALGQPVAGWAIDGVGPSAGFAVAALGSLAIAGLVVLLGVRGRTPEPVVAG"
     MSLNAYRSVL RTPQVVPTML VVLLARIPIT GVGMTLTMHV LLALDHGYAA AGLVGMAATA        60
     GSAIGSPLLG RMLDRRGLRA VVGVSIVVEA LFWLTAPLLS YPALLVTAFL SSLAALPVMS       120
     LGRQALTALV PESGRRTALA LDSMAVELAF MAGPALGVFL GTHWTGRPAM WVIGTAVVLS       180
     GLLLWVVDPP LRAGGAAPGG QAPRGWLDRR LVGVLISAGG ATFLLTGVEL ATVAQMRAQG       240
     LTEWTGAAIV VMCAASLVGG FWYGGFERPV PVWALMAGMG VLTLPLVLAG GSPWLLGPAL       300
     ALSSFLCAPT LTATGEAITT MAPEGARGTA LGLQGAAFTL GSALGQPVAG WAIDGVGPSA       360
     GFAVAALGSL AIAGLVVLLG VRGRTPEPVV AG                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page