(data stored in ACNUC7421 zone)

EMBL: CP001630.PE219

CP001630.PE219       Location/Qualifiers
FT   CDS             247767..249221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0222"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein; KEGG: eta:ETA_17240
FT                   catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34193"
FT                   /db_xref="GOA:C6WF61"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF61"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ACU34193.1"
FT                   /translation="MTDARPTTNNAGIPIASDDHSLTLGPNGPILLQDHYLIEKNAQFN
FT                   RERVPERVVHAKGGGAFGHFTTTADVSRYTKAALFQPGVRTEALLRFSTVAGELGSPDT
FT                   WRDPRGFALKLYTSQGNYDLVGNNTPVFFLRDPIKFPDFIRSQKRRVDTGRRDHDMQWD
FT                   FWTLQPETAHQVTWLMGDRGIPRTWRHQNGYGSHTYLWENAEGERHWVKYHFKTDQGIE
FT                   TLTADEAARIAGEDADAHRADLWHAVERGEFPSWTLHVQVMPYEDAAGYRFNPFDLTKV
FT                   WPQGDYPLIEVGKLVLDRNPSDHFAEIEQAAFEPTNLVPGIGASPDKMLLGRIFAYPDA
FT                   HRYRIGANYAQLPVNRPKSRVDSYAKDGAMRYGNASDPVYAPNSYGGPHASAAVGSEAT
FT                   TSYGVEDAVVRSAYRLHPEDDDWGQAGTLVREVMDDAQRDRLVETVVAHAGNGVSEPVL
FT                   RRVFEYWRNIDKGVGDRIAAAFDGRS"
     MTDARPTTNN AGIPIASDDH SLTLGPNGPI LLQDHYLIEK NAQFNRERVP ERVVHAKGGG        60
     AFGHFTTTAD VSRYTKAALF QPGVRTEALL RFSTVAGELG SPDTWRDPRG FALKLYTSQG       120
     NYDLVGNNTP VFFLRDPIKF PDFIRSQKRR VDTGRRDHDM QWDFWTLQPE TAHQVTWLMG       180
     DRGIPRTWRH QNGYGSHTYL WENAEGERHW VKYHFKTDQG IETLTADEAA RIAGEDADAH       240
     RADLWHAVER GEFPSWTLHV QVMPYEDAAG YRFNPFDLTK VWPQGDYPLI EVGKLVLDRN       300
     PSDHFAEIEQ AAFEPTNLVP GIGASPDKML LGRIFAYPDA HRYRIGANYA QLPVNRPKSR       360
     VDSYAKDGAM RYGNASDPVY APNSYGGPHA SAAVGSEATT SYGVEDAVVR SAYRLHPEDD       420
     DWGQAGTLVR EVMDDAQRDR LVETVVAHAG NGVSEPVLRR VFEYWRNIDK GVGDRIAAAF       480
     DGRS                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page