(data stored in ACNUC7421 zone)

EMBL: CP001630.PE22

CP001630.PE22        Location/Qualifiers
FT   CDS             complement(23322..25025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0022"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: ade:Adeh_3649
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33996"
FT                   /db_xref="GOA:C6WCH5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU33996.1"
FT                   /translation="MLSSGQLLAERYRLTRRIAVGGMGEVWEAADTRLDRNVAVKVLKA
FT                   ELSGDAEFLNRFRIEARTTASLNHPGIAGVHDYGETASEPDGPEDTAYLVMELVEGEPL
FT                   AAVIARGRMNAERVLDVLEQAGTALQAAHERGLVHRDVKPGNILVTPDGKVKITDFGIA
FT                   KAADAAPVTRSGMVMGTAHYIAPEQATGHDAEPASDVYALAVCGYECLVGHRPFRSENA
FT                   VTVAMMHIRDVAPPLPPDVPPAVRALIEATLVKDPRQRYRNGGEFASAVAAVRAGQPLP
FT                   APSGLAMAVGGPQLAPPPQAPPSQQLPVQQLQVQPMQAQPMQAQSMQAQPMQAQSMQAQ
FT                   PMSAPPMQAQPMSAPPMPQQPMPSQQLPAQLAPPQQLAAPPPVAPQQLTPPAQLTHPGI
FT                   PVTHPGSRPGMQPIHPPAAGPHTGAFHPPGAPGRHPGRGRPLLWVMVAFLVIALIALSV
FT                   LIVREIAGDDGVPGGPSPQGSTPSASRAAPEDATDRFPGRPTVEITGADYLGAPADEVA
FT                   ATLTGHGVEPEVRSERGGAPADARRCRVSELEPEGEVPIGSRVRVTCVPT"
     MLSSGQLLAE RYRLTRRIAV GGMGEVWEAA DTRLDRNVAV KVLKAELSGD AEFLNRFRIE        60
     ARTTASLNHP GIAGVHDYGE TASEPDGPED TAYLVMELVE GEPLAAVIAR GRMNAERVLD       120
     VLEQAGTALQ AAHERGLVHR DVKPGNILVT PDGKVKITDF GIAKAADAAP VTRSGMVMGT       180
     AHYIAPEQAT GHDAEPASDV YALAVCGYEC LVGHRPFRSE NAVTVAMMHI RDVAPPLPPD       240
     VPPAVRALIE ATLVKDPRQR YRNGGEFASA VAAVRAGQPL PAPSGLAMAV GGPQLAPPPQ       300
     APPSQQLPVQ QLQVQPMQAQ PMQAQSMQAQ PMQAQSMQAQ PMSAPPMQAQ PMSAPPMPQQ       360
     PMPSQQLPAQ LAPPQQLAAP PPVAPQQLTP PAQLTHPGIP VTHPGSRPGM QPIHPPAAGP       420
     HTGAFHPPGA PGRHPGRGRP LLWVMVAFLV IALIALSVLI VREIAGDDGV PGGPSPQGST       480
     PSASRAAPED ATDRFPGRPT VEITGADYLG APADEVAATL TGHGVEPEVR SERGGAPADA       540
     RRCRVSELEP EGEVPIGSRV RVTCVPT                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page