(data stored in ACNUC7421 zone)

EMBL: CP001630.PE220

CP001630.PE220       Location/Qualifiers
FT   CDS             249410..249832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0223"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bpy:Bphyt_6798 OsmC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34194"
FT                   /db_xref="GOA:C6WF62"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF62"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACU34194.1"
FT                   /translation="MNVLYTAEAIAVGDGRNGEVRSSDGVIDEQLAMPKELGGPGGDKT
FT                   NPEQLFAAGYAACFHSALKRVAGQAKADITDSTVTAKVGIGPNDQGGFGLTVELAVHIP
FT                   GADEAAAHKLVETAHQVCPYSNATRGNIEVALTTTV"
     MNVLYTAEAI AVGDGRNGEV RSSDGVIDEQ LAMPKELGGP GGDKTNPEQL FAAGYAACFH        60
     SALKRVAGQA KADITDSTVT AKVGIGPNDQ GGFGLTVELA VHIPGADEAA AHKLVETAHQ       120
     VCPYSNATRG NIEVALTTTV                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page