(data stored in ACNUC7421 zone)

EMBL: CP001630.PE221

CP001630.PE221       Location/Qualifiers
FT   CDS             249865..250341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0224"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   mpo:Mpop_0322 ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34195"
FT                   /db_xref="GOA:C6WF63"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF63"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACU34195.1"
FT                   /translation="MSKSPITSPLSDEAKDAVGHVLQATLVDLVDLSLVAKQAHWNVVG
FT                   KNFRSVHLQLDELVTTARTYADQVAERAAALGVTPNGKARTVAESSGVPEFPDGWLKED
FT                   DVVKAVVTTLAALIGRMRERIDETDKPDPVTQDLLIEITKQFEEAHWMWQAQQA"
     MSKSPITSPL SDEAKDAVGH VLQATLVDLV DLSLVAKQAH WNVVGKNFRS VHLQLDELVT        60
     TARTYADQVA ERAAALGVTP NGKARTVAES SGVPEFPDGW LKEDDVVKAV VTTLAALIGR       120
     MRERIDETDK PDPVTQDLLI EITKQFEEAH WMWQAQQA                               158
//

If you have problems or comments...

PBIL Back to PBIL home page