(data stored in ACNUC7421 zone)

EMBL: CP001630.PE222

CP001630.PE222       Location/Qualifiers
FT   CDS             complement(250415..250981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0225"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bpl:BURPS1106A_A1934 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34196"
FT                   /db_xref="GOA:C6WF64"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF64"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ACU34196.1"
FT                   /translation="MTVTVVGIGGSLRANSSSERALRLVLSGAAETGARIVEVSGPDLV
FT                   LPFYDPTEPTRPEAARRLVEALRVADGVVLVSPGYHGTVSGLVKNALDYVEDLRGDERP
FT                   YLDGRAVGCVATAMGWQASVTTLTSLRSIVHALRGWPTPLGASVNTREVKFDEAGECSS
FT                   AEVAEQLRTVGRQVGEFAASRAKRW"
     MTVTVVGIGG SLRANSSSER ALRLVLSGAA ETGARIVEVS GPDLVLPFYD PTEPTRPEAA        60
     RRLVEALRVA DGVVLVSPGY HGTVSGLVKN ALDYVEDLRG DERPYLDGRA VGCVATAMGW       120
     QASVTTLTSL RSIVHALRGW PTPLGASVNT REVKFDEAGE CSSAEVAEQL RTVGRQVGEF       180
     AASRAKRW                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page