(data stored in ACNUC7421 zone)

EMBL: CP001630.PE223

CP001630.PE223       Location/Qualifiers
FT   CDS             251061..252113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0226"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: rce:RC1_2418 lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34197"
FT                   /db_xref="GOA:C6WF65"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF65"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACU34197.1"
FT                   /translation="MSKLADRVPTGVLAAGLRAAFALPAPVRRLLTGPPRVVHGQTLHP
FT                   DTQLLLRMQELSGTGWSTSSPATSRASLRRTTALVEGPGPHRVVTRQVLVDEHLKARHY
FT                   TPQGLPEGSPLLVFLHGGGWVSGDLETHDDLCRHLAVGAGVRVLAVDYRLAPEHRFPAA
FT                   ADDADAAYRYAVANAEELGADPDRIALGGDSAGGNLAASAALSAADADHRPAFLLLLYP
FT                   SLDATATGGSRDLFARGFFLTRPKMDWFMGNYAPDPSTHHDPRLSPLLAPDLSVLPPTY
FT                   VATAGLDPLRDEGEAFAARLAESGVPVVLRRHDGLIHGFANVLGVGTAGREAVAEAIGA
FT                   LRTGLALRRA"
     MSKLADRVPT GVLAAGLRAA FALPAPVRRL LTGPPRVVHG QTLHPDTQLL LRMQELSGTG        60
     WSTSSPATSR ASLRRTTALV EGPGPHRVVT RQVLVDEHLK ARHYTPQGLP EGSPLLVFLH       120
     GGGWVSGDLE THDDLCRHLA VGAGVRVLAV DYRLAPEHRF PAAADDADAA YRYAVANAEE       180
     LGADPDRIAL GGDSAGGNLA ASAALSAADA DHRPAFLLLL YPSLDATATG GSRDLFARGF       240
     FLTRPKMDWF MGNYAPDPST HHDPRLSPLL APDLSVLPPT YVATAGLDPL RDEGEAFAAR       300
     LAESGVPVVL RRHDGLIHGF ANVLGVGTAG REAVAEAIGA LRTGLALRRA                  350
//

If you have problems or comments...

PBIL Back to PBIL home page