(data stored in ACNUC7421 zone)

EMBL: CP001630.PE224

CP001630.PE224       Location/Qualifiers
FT   CDS             complement(252213..254027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0227"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S15; KEGG: pzu:PHZ_c2763
FT                   dipeptidyl aminopeptidase/acylaminoacyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34198"
FT                   /db_xref="GOA:C6WF66"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF66"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACU34198.1"
FT                   /translation="MTTHPTAPVPDPLFPDPEAEARWRDRFTAPRVSLPQWAEDAPDRN
FT                   LYLSNSSGVWEVYAWDRASDEHRKVTDRPNGTSHAALTPDGERIWWFSDTDGDEFGVWV
FT                   TEPFTATGDKAEPAVPDVPAAYPAGLGIGDEVVVIGASTDDGTTVYLSRAGGPAEVLYR
FT                   HANDAGLGALSKDETLVAIAHSEHGDNRHTALRVLTTSGETAAEKWDGPGKGLDAIAFS
FT                   PVRGDNRLLVMHERRGREELLVWDVAADAETEVVVDLPGEISADWYPEADALLVVHTFR
FT                   ARNTLHRYDLATGALTALETPHGSVGSVGVRPDGDVEYSWSSAARPGVVRVLTASGEDR
FT                   VLLSPAGHRPPPSAELRDVFVGDVHALVARPEGAPDGPLPTVFSLHGGPHAADEDRFSA
FT                   YRAVWLDAGFAVVHVNYRGSTGYGSAWRDAIEGRPGLTELEDVAAVHDWAVREGFADPA
FT                   RCVVNGASWGGYLSLLALGTQPERWAAGVAGVPVADYLAAYEDEMEPLRAFDRALFGGS
FT                   PQEVPERYRLCSPLTYVDEVRAPVLVLAGENDPRCPIRQIDNYLDRLAARGSEYEVYRY
FT                   DAGHGSLVVAETIAQTAAEVDFVRRRLG"
     MTTHPTAPVP DPLFPDPEAE ARWRDRFTAP RVSLPQWAED APDRNLYLSN SSGVWEVYAW        60
     DRASDEHRKV TDRPNGTSHA ALTPDGERIW WFSDTDGDEF GVWVTEPFTA TGDKAEPAVP       120
     DVPAAYPAGL GIGDEVVVIG ASTDDGTTVY LSRAGGPAEV LYRHANDAGL GALSKDETLV       180
     AIAHSEHGDN RHTALRVLTT SGETAAEKWD GPGKGLDAIA FSPVRGDNRL LVMHERRGRE       240
     ELLVWDVAAD AETEVVVDLP GEISADWYPE ADALLVVHTF RARNTLHRYD LATGALTALE       300
     TPHGSVGSVG VRPDGDVEYS WSSAARPGVV RVLTASGEDR VLLSPAGHRP PPSAELRDVF       360
     VGDVHALVAR PEGAPDGPLP TVFSLHGGPH AADEDRFSAY RAVWLDAGFA VVHVNYRGST       420
     GYGSAWRDAI EGRPGLTELE DVAAVHDWAV REGFADPARC VVNGASWGGY LSLLALGTQP       480
     ERWAAGVAGV PVADYLAAYE DEMEPLRAFD RALFGGSPQE VPERYRLCSP LTYVDEVRAP       540
     VLVLAGENDP RCPIRQIDNY LDRLAARGSE YEVYRYDAGH GSLVVAETIA QTAAEVDFVR       600
     RRLG                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page