(data stored in ACNUC7421 zone)

EMBL: CP001630.PE225

CP001630.PE225       Location/Qualifiers
FT   CDS             complement(254024..254854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0228"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Cyclopropane-fatty-
FT                   acyl-phospholipid synthase; Methyltransferase type 12;
FT                   KEGG: hha:Hhal_0984 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34199"
FT                   /db_xref="GOA:C6WF67"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF67"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU34199.1"
FT                   /translation="MDPATPPQAPAPDHRADHRAELRRAYATGELAGLPVFGGGFINFG
FT                   FWRGIPLHGPLSAEDRVASQAALYDLVLDALSPTGRSTLEIGCGQGVGALRVLLRAPSR
FT                   CAGVDQEPEQVGRARLAAPEGEFAVGSAGALPFGDGEFERLLSVEAAQHFDDLGAFARE
FT                   AARVLSPGGRLAVATFFAADASAAPELSRLLATFARGLDLPHPIGGFLDRLREAGFGDV
FT                   AATSVGEHVWRGLDRWLELGPAPERWDRNWLVAAERGLLDYHLVTATKPAGSGV"
     MDPATPPQAP APDHRADHRA ELRRAYATGE LAGLPVFGGG FINFGFWRGI PLHGPLSAED        60
     RVASQAALYD LVLDALSPTG RSTLEIGCGQ GVGALRVLLR APSRCAGVDQ EPEQVGRARL       120
     AAPEGEFAVG SAGALPFGDG EFERLLSVEA AQHFDDLGAF AREAARVLSP GGRLAVATFF       180
     AADASAAPEL SRLLATFARG LDLPHPIGGF LDRLREAGFG DVAATSVGEH VWRGLDRWLE       240
     LGPAPERWDR NWLVAAERGL LDYHLVTATK PAGSGV                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page