(data stored in ACNUC7421 zone)

EMBL: CP001630.PE227

CP001630.PE227       Location/Qualifiers
FT   CDS             complement(256654..257529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34201"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF69"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34201.1"
FT                   /translation="MPNLSRVDQVKRAIDRACSLHKSTGVRRTGLDRALGPELRALWGV
FT                   GGSDSPDRVRAKAVLQLERVFAGLDPVVAAVARGWFNTSLDPAWWELNLTGRKRRLREG
FT                   LDLSQRTLERRFGDEAQPALIASLRAGPAPVPPADVLARLDAERRAVAGDPPDDGADER
FT                   IGRFREPVPPLEQALRFAREEPLHGLRDREGRPVVLDAGGHGAWMPVFSTRARLREYLL
FT                   ANPAFDGFAFTSTGPKLAAELTARHPGTGLAVNPVADPEGNLGRTFTLLPEQVWELLPI
FT                   RRSPGENRAG"
     MPNLSRVDQV KRAIDRACSL HKSTGVRRTG LDRALGPELR ALWGVGGSDS PDRVRAKAVL        60
     QLERVFAGLD PVVAAVARGW FNTSLDPAWW ELNLTGRKRR LREGLDLSQR TLERRFGDEA       120
     QPALIASLRA GPAPVPPADV LARLDAERRA VAGDPPDDGA DERIGRFREP VPPLEQALRF       180
     AREEPLHGLR DREGRPVVLD AGGHGAWMPV FSTRARLREY LLANPAFDGF AFTSTGPKLA       240
     AELTARHPGT GLAVNPVADP EGNLGRTFTL LPEQVWELLP IRRSPGENRA G                291
//

If you have problems or comments...

PBIL Back to PBIL home page