(data stored in ACNUC7421 zone)

EMBL: CP001630.PE228

CP001630.PE228       Location/Qualifiers
FT   CDS             complement(258162..259121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0233"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: hch:HCH_04892
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34202"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF70"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACU34202.1"
FT                   /translation="MNTFGRSLLATTALGTAALAYAAGIERRHWTLRRATIPVLAPGST
FT                   PLKVLHFSDLHMTPNQTSKQRWVAGLAELEPDLVVNTGDNLAHPQAVPGVIRALGPLLD
FT                   FPGVFVFGSNDYYAPRPKNPARYLLPSAKTKRIHGLDLPWRDLRAAMVERGWIDLTHVR
FT                   TSFEAGGQRIVAAGLDDPHLKRDRYSEIAGAPGKAALRLGVTHSPEPRVLDPFAADGYD
FT                   LVLAGHTHGGQLRVPGYGALVTNCDLDRGRARGVSRWGAHMWLNVSAGLGTSPYAPVRF
FT                   ACPPEASLLTLVPRDVDAGQSDDEAKRDTDFRVRGNVR"
     MNTFGRSLLA TTALGTAALA YAAGIERRHW TLRRATIPVL APGSTPLKVL HFSDLHMTPN        60
     QTSKQRWVAG LAELEPDLVV NTGDNLAHPQ AVPGVIRALG PLLDFPGVFV FGSNDYYAPR       120
     PKNPARYLLP SAKTKRIHGL DLPWRDLRAA MVERGWIDLT HVRTSFEAGG QRIVAAGLDD       180
     PHLKRDRYSE IAGAPGKAAL RLGVTHSPEP RVLDPFAADG YDLVLAGHTH GGQLRVPGYG       240
     ALVTNCDLDR GRARGVSRWG AHMWLNVSAG LGTSPYAPVR FACPPEASLL TLVPRDVDAG       300
     QSDDEAKRDT DFRVRGNVR                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page