(data stored in ACNUC7421 zone)

EMBL: CP001630.PE229

CP001630.PE229       Location/Qualifiers
FT   CDS             259185..259652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0234"
FT                   /product="GatB/YqeY domain protein"
FT                   /note="KEGG: mxa:MXAN_5202 GatB/YqeY domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34203"
FT                   /db_xref="GOA:C6WF71"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF71"
FT                   /inference="similar to AA sequence:KEGG:MXAN_5202"
FT                   /protein_id="ACU34203.1"
FT                   /translation="MAQLKARLQSDLTGAMKNRESVTAGALRMALTAVTNEEVSGKTAR
FT                   ELTDDEVLKVLGREVKKRREAAEAFANAGRDEKAELERQELAILEAYLPKQLDDAELAA
FT                   LVDEAVAELAQGGEQPGLKQMGLVMKAANAKVAGRAEGGRVAAAVKARLNA"
     MAQLKARLQS DLTGAMKNRE SVTAGALRMA LTAVTNEEVS GKTARELTDD EVLKVLGREV        60
     KKRREAAEAF ANAGRDEKAE LERQELAILE AYLPKQLDDA ELAALVDEAV AELAQGGEQP       120
     GLKQMGLVMK AANAKVAGRA EGGRVAAAVK ARLNA                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page