(data stored in ACNUC7421 zone)

EMBL: CP001630.PE23

CP001630.PE23        Location/Qualifiers
FT   CDS             complement(25025..26491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0023"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: penicillin-binding protein 2; K05515 penicillin
FT                   binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33997"
FT                   /db_xref="GOA:C6WCH6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH6"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACU33997.1"
FT                   /translation="MNTPLRRVGVAMMVMMMILLANATYVQVIKAEEYRTSPYNVRGRL
FT                   EMLSRERGSIIAADGTPLATVTPIPDKDRWQRVYANGPMYLPVTGYLSNTYGSNGLERA
FT                   ENDLLIGEDDRLFTRRLSDLITGRDPKGASLQVTINPKAQQAAYEALGDRTGAVVAIEP
FT                   KTGKILALVSTPSFDPNKLAVQDGQEEKAYWAEVTQDNPAQPDANRALSWTYPPGSTFK
FT                   LVVAAAGLEEGMDKSTQVDARPTITLPGTNTELPNFNGTNCNNGVNATLEQAIAQSCNT
FT                   AFAKLAGDLGTAKLREQAAKFGIDDQKYQVPMTTAASTLGPVPDQAALFQTGIGQRDVQ
FT                   VTPLANAVMVATIANKGVRMKPYLVDKILGTDTATVDETKPDEVDEAISEDSAQLLTEM
FT                   MIAAENKAGGAGKLSNIQIASKTGTAEWGVGSTPNPHAWYTAFAPANDPQIALAVIVEK
FT                   SGGKRDGAATGSLVAAPVGRAVISSYLGSR"
     MNTPLRRVGV AMMVMMMILL ANATYVQVIK AEEYRTSPYN VRGRLEMLSR ERGSIIAADG        60
     TPLATVTPIP DKDRWQRVYA NGPMYLPVTG YLSNTYGSNG LERAENDLLI GEDDRLFTRR       120
     LSDLITGRDP KGASLQVTIN PKAQQAAYEA LGDRTGAVVA IEPKTGKILA LVSTPSFDPN       180
     KLAVQDGQEE KAYWAEVTQD NPAQPDANRA LSWTYPPGST FKLVVAAAGL EEGMDKSTQV       240
     DARPTITLPG TNTELPNFNG TNCNNGVNAT LEQAIAQSCN TAFAKLAGDL GTAKLREQAA       300
     KFGIDDQKYQ VPMTTAASTL GPVPDQAALF QTGIGQRDVQ VTPLANAVMV ATIANKGVRM       360
     KPYLVDKILG TDTATVDETK PDEVDEAISE DSAQLLTEMM IAAENKAGGA GKLSNIQIAS       420
     KTGTAEWGVG STPNPHAWYT AFAPANDPQI ALAVIVEKSG GKRDGAATGS LVAAPVGRAV       480
     ISSYLGSR                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page