(data stored in ACNUC7421 zone)

EMBL: CP001630.PE230

CP001630.PE230       Location/Qualifiers
FT   CDS             complement(259758..262250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0235"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51; PASTA domain
FT                   containing protein; penicillin-binding protein
FT                   transpeptidase; SMART: PASTA domain containing protein;
FT                   KEGG: azc:AZC_0337 penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34204"
FT                   /db_xref="GOA:C6WF72"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF72"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ACU34204.1"
FT                   /translation="MRVRNSVLKLLGLCVLAGVLLAGALFPAVGALGVVSNQASDTVDS
FT                   ISSDLVTTDPPLITTITDRDGAPIAYLYDQYRVLVPPEDISPTMKAALVSVEDRRFYEH
FT                   QGVDWKGTTRAALTNQFSGSVTQGASTLTQQYVKNYLVHVVARNNKVEQQKAQEQTIAR
FT                   KMREARISLQLERKLGKEEILARYLNVVPFGSTIYGIAAASQAYFSTTADKLTVAQSAM
FT                   LAGMVNSPSALDPEVFPEKALERRNQVIDKMVENDKLSRDAAFEAKREPLGLAEPVRTP
FT                   PNGCVGAGPENGFFCSYVVEYLERNGFSIEQLKIGGYTVRTTLDRDITQKAKRAAEGQV
FT                   AKDTSGIANTMAVVRPGKESHEVVALVANRDYGLKADQFQTQFDLPSGVENKFGAGSIY
FT                   KVFTAAAALEKGMGIENVIPTPTFYESRVFKGGGNRCRSTGEPNTRWYCLGNDSATYSS
FT                   QMPLQQALQTSPNTGFVILEERLGMEPVVDMASRLGMRETMATNISGTPPDPRSKQREL
FT                   RVSQSEFYKQDGGNASFTLGPASASTLELANVAATIISGGTWCPPSPVAEVLDRDGQAV
FT                   PVNEAPCEQVVNEQLANGLAVGMSKDDQNGGTAAAAARGVKWTRPMLGKTGTTEEYKSA
FT                   AFIGATPDYAGAVQTYNDGPNPQPICVTGKPRLCANGNIYGGTVPARTWFDTMSQIHEG
FT                   LPVQQLPKVEPRYLKGGDEIRVPDVVGKSVNDATRVLQEAGYKVAQQSRNSAQAKGTVV
FT                   SQTPRGSALQGTLITLLVSTGYVPPPAPTQQPTQQPPTQGQPEQPTQPTQPGGQPGGGT
FT                   PGTPGQPGGPTRPTRPTR"
     MRVRNSVLKL LGLCVLAGVL LAGALFPAVG ALGVVSNQAS DTVDSISSDL VTTDPPLITT        60
     ITDRDGAPIA YLYDQYRVLV PPEDISPTMK AALVSVEDRR FYEHQGVDWK GTTRAALTNQ       120
     FSGSVTQGAS TLTQQYVKNY LVHVVARNNK VEQQKAQEQT IARKMREARI SLQLERKLGK       180
     EEILARYLNV VPFGSTIYGI AAASQAYFST TADKLTVAQS AMLAGMVNSP SALDPEVFPE       240
     KALERRNQVI DKMVENDKLS RDAAFEAKRE PLGLAEPVRT PPNGCVGAGP ENGFFCSYVV       300
     EYLERNGFSI EQLKIGGYTV RTTLDRDITQ KAKRAAEGQV AKDTSGIANT MAVVRPGKES       360
     HEVVALVANR DYGLKADQFQ TQFDLPSGVE NKFGAGSIYK VFTAAAALEK GMGIENVIPT       420
     PTFYESRVFK GGGNRCRSTG EPNTRWYCLG NDSATYSSQM PLQQALQTSP NTGFVILEER       480
     LGMEPVVDMA SRLGMRETMA TNISGTPPDP RSKQRELRVS QSEFYKQDGG NASFTLGPAS       540
     ASTLELANVA ATIISGGTWC PPSPVAEVLD RDGQAVPVNE APCEQVVNEQ LANGLAVGMS       600
     KDDQNGGTAA AAARGVKWTR PMLGKTGTTE EYKSAAFIGA TPDYAGAVQT YNDGPNPQPI       660
     CVTGKPRLCA NGNIYGGTVP ARTWFDTMSQ IHEGLPVQQL PKVEPRYLKG GDEIRVPDVV       720
     GKSVNDATRV LQEAGYKVAQ QSRNSAQAKG TVVSQTPRGS ALQGTLITLL VSTGYVPPPA       780
     PTQQPTQQPP TQGQPEQPTQ PTQPGGQPGG GTPGTPGQPG GPTRPTRPTR                  830
//

If you have problems or comments...

PBIL Back to PBIL home page