(data stored in ACNUC7421 zone)

EMBL: CP001630.PE231

CP001630.PE231       Location/Qualifiers
FT   CDS             262504..262797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0236"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34205"
FT                   /db_xref="GOA:C6WF73"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF73"
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /protein_id="ACU34205.1"
FT                   /translation="MQQQGDWRIKAACRDGEPDQLFVRGAEQRKVKVVCLGCPVRTECL
FT                   AEALDNRIEFGVWGGMTERERRALLKRRPDVTSWLELLDSARTDHYEESAAG"
     MQQQGDWRIK AACRDGEPDQ LFVRGAEQRK VKVVCLGCPV RTECLAEALD NRIEFGVWGG        60
     MTERERRALL KRRPDVTSWL ELLDSARTDH YEESAAG                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page