(data stored in ACNUC7421 zone)

EMBL: CP001630.PE232

CP001630.PE232       Location/Qualifiers
FT   CDS             complement(262823..263947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0237"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG:
FT                   acp:A2cp1_0984 adventurous gliding motility protein R"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34206"
FT                   /db_xref="GOA:C6WF74"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF74"
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /protein_id="ACU34206.1"
FT                   /translation="MNRLDVDALLDDPATRVLVCCGSGGVGKTTTAAALALRAAERGRR
FT                   AVVLTIDPARRLAQSLGLRELDNSPRPVVVEGFEPEGELHAMMLDMRRTFDDMVLAHAG
FT                   RERAQQILANPFYQTISTSFSGTQEYMAMEKLGQLVARDEWDLVVVDTPPSRSALDFLD
FT                   APQRLSTVLDGKLIKMLSAPARAGGRGIMKIVGTGFTLFTKAVSTIVGGQLLQDASTFV
FT                   QAFDSMFGGFRQRAQATYELLRSPGTEFLVVAAAEPDALREASYFVERLSAEEMPLAGL
FT                   VANRTHPVLAGLAPAGAEAAADRLEERVGGPSLASAVLRVHSDRVAVADREKRLLARFT
FT                   RAHPGVPLVGVPALPTDVHDLDGLREIGRRLAGE"
     MNRLDVDALL DDPATRVLVC CGSGGVGKTT TAAALALRAA ERGRRAVVLT IDPARRLAQS        60
     LGLRELDNSP RPVVVEGFEP EGELHAMMLD MRRTFDDMVL AHAGRERAQQ ILANPFYQTI       120
     STSFSGTQEY MAMEKLGQLV ARDEWDLVVV DTPPSRSALD FLDAPQRLST VLDGKLIKML       180
     SAPARAGGRG IMKIVGTGFT LFTKAVSTIV GGQLLQDAST FVQAFDSMFG GFRQRAQATY       240
     ELLRSPGTEF LVVAAAEPDA LREASYFVER LSAEEMPLAG LVANRTHPVL AGLAPAGAEA       300
     AADRLEERVG GPSLASAVLR VHSDRVAVAD REKRLLARFT RAHPGVPLVG VPALPTDVHD       360
     LDGLREIGRR LAGE                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page