(data stored in ACNUC7421 zone)

EMBL: CP001630.PE233

CP001630.PE233       Location/Qualifiers
FT   CDS             complement(263944..264936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0238"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG:
FT                   afw:Anae109_0972 chromosome partitioning-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34207"
FT                   /db_xref="GOA:C6WF75"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF75"
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /protein_id="ACU34207.1"
FT                   /translation="MTGWTDELSRARLHVVTGKGGTGKTTVAAALALALATGGRRVLLV
FT                   EVENRQGLAQLFDRPPLPYSEERIASAPGGGEVRALAVDPEAALLEYLAMFYNLGFAGR
FT                   TLRRMGAIEFATTLAPGLRDVLLTGKVKECVRRVGKSGRHEYDAVVLDAPPTGRVVRFL
FT                   DVTRAMADLAKVGPIKGQSEGVVALLHSGDTAVHLVSLLEEMPVRETLDAVAELDGADL
FT                   RPGAVFVNRARPHRLPPDAVLKAAEGGIDPAELREGFAEAGLVVPDEDLDGLAEQTADH
FT                   AQRVLAEARAKDKLAEADLPTLELPELTGGVDVAALYELAESLVERGVR"
     MTGWTDELSR ARLHVVTGKG GTGKTTVAAA LALALATGGR RVLLVEVENR QGLAQLFDRP        60
     PLPYSEERIA SAPGGGEVRA LAVDPEAALL EYLAMFYNLG FAGRTLRRMG AIEFATTLAP       120
     GLRDVLLTGK VKECVRRVGK SGRHEYDAVV LDAPPTGRVV RFLDVTRAMA DLAKVGPIKG       180
     QSEGVVALLH SGDTAVHLVS LLEEMPVRET LDAVAELDGA DLRPGAVFVN RARPHRLPPD       240
     AVLKAAEGGI DPAELREGFA EAGLVVPDED LDGLAEQTAD HAQRVLAEAR AKDKLAEADL       300
     PTLELPELTG GVDVAALYEL AESLVERGVR                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page