(data stored in ACNUC7421 zone)

EMBL: CP001630.PE235

CP001630.PE235       Location/Qualifiers
FT   CDS             266128..266283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34209"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF77"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34209.1"
FT                   /translation="MQKWEYATVPLLTHATKQILDQWGEDGWELVSVLTGPTGEQHVAY
FT                   LKRPKS"
     MQKWEYATVP LLTHATKQIL DQWGEDGWEL VSVLTGPTGE QHVAYLKRPK S                 51
//

If you have problems or comments...

PBIL Back to PBIL home page