(data stored in ACNUC7421 zone)

EMBL: CP001630.PE236

CP001630.PE236       Location/Qualifiers
FT   CDS             266280..266738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0241"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rce:RC1_1921
FT                   endoribonuclease L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34210"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF78"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ACU34210.1"
FT                   /translation="MTWTDRLAELGVELPEVAAPVAAYVPAVRTGSLVFTSGQLPFVGG
FT                   ALAATGKVGAEVSPEEAKAHARTCALNALAAVHALVGVDSVARVVKVVGFVASADGFTG
FT                   QPAVVNGASEFLGEVFGDAGAHARSAVGVAELPLGAPVEVELVVEIRE"
     MTWTDRLAEL GVELPEVAAP VAAYVPAVRT GSLVFTSGQL PFVGGALAAT GKVGAEVSPE        60
     EAKAHARTCA LNALAAVHAL VGVDSVARVV KVVGFVASAD GFTGQPAVVN GASEFLGEVF       120
     GDAGAHARSA VGVAELPLGA PVEVELVVEI RE                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page