(data stored in ACNUC7421 zone)

EMBL: CP001630.PE237

CP001630.PE237       Location/Qualifiers
FT   CDS             266740..267351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34211"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF79"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34211.1"
FT                   /translation="MSDTLHELLLRLSGRLPDDVMWRFRDWAATDAVSVLARTLPRTLL
FT                   HDRVGLTDHEQRLLESALVPHGADRAATSSIRALDELPETDFAFTPESPDRAAMGDSAT
FT                   VVLGATLRGRPGVGEVRSSWRQVGGRNGRTNRVILVTATSGCARLAGELQRVLRALGEH
FT                   DPCVEVLPAGLEPPPYHRAALASSELVCTGAEDEGHLVTV"
     MSDTLHELLL RLSGRLPDDV MWRFRDWAAT DAVSVLARTL PRTLLHDRVG LTDHEQRLLE        60
     SALVPHGADR AATSSIRALD ELPETDFAFT PESPDRAAMG DSATVVLGAT LRGRPGVGEV       120
     RSSWRQVGGR NGRTNRVILV TATSGCARLA GELQRVLRAL GEHDPCVEVL PAGLEPPPYH       180
     RAALASSELV CTGAEDEGHL VTV                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page