(data stored in ACNUC7421 zone)

EMBL: CP001630.PE238

CP001630.PE238       Location/Qualifiers
FT   CDS             267390..268634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0243"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34212"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF80"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34212.1"
FT                   /translation="MAQDGTGLPVRLHDLLLALAGRVDDDALAQAREMLAVSELDRAVD
FT                   HVVGCLIAGRIPVRAEEREELGALLGEVRSDPLLADRLLAVETLPHVRHRFTSESDPTK
FT                   DLADVLGRTASALPDVRSVRCTWRSSPAGATPGPLPQRVVLVDIGPKGFPTATAYRLDT
FT                   VLRKAGIRASVEVLIVGKPMNEYHAAASSSSREVYFPSAPLGAKGEAPDNAAWFDGEVR
FT                   DKAPVIEPEPVPADDNQNGSTKSRRGRDEAFEAIQPFPPKPVKRTAARDQAQKGEPAPP
FT                   AAPEQQTPPPPPPPPPVAPPPAPKAAPAPPPVVPVAPPVAPPPALPEDSPFSRAEVTME
FT                   LNPEDLAALQAALADGQAPASVNLPPTVDAKLSDRERALLQQLHEELAQREQQTWPGGA
FT                   EYVNGVPKPNNGKFS"
     MAQDGTGLPV RLHDLLLALA GRVDDDALAQ AREMLAVSEL DRAVDHVVGC LIAGRIPVRA        60
     EEREELGALL GEVRSDPLLA DRLLAVETLP HVRHRFTSES DPTKDLADVL GRTASALPDV       120
     RSVRCTWRSS PAGATPGPLP QRVVLVDIGP KGFPTATAYR LDTVLRKAGI RASVEVLIVG       180
     KPMNEYHAAA SSSSREVYFP SAPLGAKGEA PDNAAWFDGE VRDKAPVIEP EPVPADDNQN       240
     GSTKSRRGRD EAFEAIQPFP PKPVKRTAAR DQAQKGEPAP PAAPEQQTPP PPPPPPPVAP       300
     PPAPKAAPAP PPVVPVAPPV APPPALPEDS PFSRAEVTME LNPEDLAALQ AALADGQAPA       360
     SVNLPPTVDA KLSDRERALL QQLHEELAQR EQQTWPGGAE YVNGVPKPNN GKFS             414
//

If you have problems or comments...

PBIL Back to PBIL home page