(data stored in ACNUC7421 zone)

EMBL: CP001630.PE239

CP001630.PE239       Location/Qualifiers
FT   CDS             complement(268651..269457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34213"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF81"
FT                   /inference="similar to AA sequence:KEGG:Adeh_3797"
FT                   /protein_id="ACU34213.1"
FT                   /translation="MSAVDGLARYAAGLACAARGAWREAEAHHAGALAAWGRDGRAAAV
FT                   DRGLVERARDGADACATAAEVAVELHRLVPAAHRRGAALLAASGARSPHVRVLADLASL
FT                   LARGPAPLGVVRALHRRTPGLAAALTDREWLVVGGSVRATPRCAEFLRAVNAAHAEAVE
FT                   RLWPDPPVVELVVEHPMAAARTGPSPQARLFDLLRALRYQRADAHHTAAHYTAAHHTAA
FT                   HQAAGAEHRSTSEDERVTDLAASAPYRRIDRARRAALVTDLRGLAD"
     MSAVDGLARY AAGLACAARG AWREAEAHHA GALAAWGRDG RAAAVDRGLV ERARDGADAC        60
     ATAAEVAVEL HRLVPAAHRR GAALLAASGA RSPHVRVLAD LASLLARGPA PLGVVRALHR       120
     RTPGLAAALT DREWLVVGGS VRATPRCAEF LRAVNAAHAE AVERLWPDPP VVELVVEHPM       180
     AAARTGPSPQ ARLFDLLRAL RYQRADAHHT AAHYTAAHHT AAHQAAGAEH RSTSEDERVT       240
     DLAASAPYRR IDRARRAALV TDLRGLAD                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page