(data stored in ACNUC7421 zone)

EMBL: CP001630.PE24

CP001630.PE24        Location/Qualifiers
FT   CDS             complement(26488..27951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0024"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: bcb:BCB4264_A4012
FT                   stage V sporulation protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33998"
FT                   /db_xref="GOA:C6WCH7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH7"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACU33998.1"
FT                   /translation="MGSPGTGAEDTPLARASGTSPGLKPPPTKRSTELFLLAFGAVLVT
FT                   AALVLVEANQEKELSLNIIWYGLAYLVMLAVTHLAVRTWAPYADPVILPCVTLLNGIGL
FT                   VMIHRIDLGMADVLVDGEPWSAAAPKQVMWTGLSLVLFCAALKLLKDHRTLAKFGYVSG
FT                   LVGLVALILPGVLPGFIAPTINGAKIWLRFGGVSIQPGEFAKILLMVFFAAFLVSKRDL
FT                   FTIAGRRFLGMDLPRARDLGPLIAVWAVVVSVMVLQKDLGSSLLFFGIVLVLLYVATER
FT                   AVWIIIGTVLFMGAAVAAWRMFTHVQTRVDNWVDPFADPGGAGYQIVQSLFGFGTGGLF
FT                   GAGLGGGRPDQIPEANTDFIAAVIGEELGLVGLTAVLLLYTVFALRGLRNALAVRDTFG
FT                   KLLGGGLAFAVAFQVFIIIGGVMKLIPMTGITAPFLSKGGSSLLANYVLVALLLRISDA
FT                   ARSPQAPVKPRVQQPAIADQFTVMVERPK"
     MGSPGTGAED TPLARASGTS PGLKPPPTKR STELFLLAFG AVLVTAALVL VEANQEKELS        60
     LNIIWYGLAY LVMLAVTHLA VRTWAPYADP VILPCVTLLN GIGLVMIHRI DLGMADVLVD       120
     GEPWSAAAPK QVMWTGLSLV LFCAALKLLK DHRTLAKFGY VSGLVGLVAL ILPGVLPGFI       180
     APTINGAKIW LRFGGVSIQP GEFAKILLMV FFAAFLVSKR DLFTIAGRRF LGMDLPRARD       240
     LGPLIAVWAV VVSVMVLQKD LGSSLLFFGI VLVLLYVATE RAVWIIIGTV LFMGAAVAAW       300
     RMFTHVQTRV DNWVDPFADP GGAGYQIVQS LFGFGTGGLF GAGLGGGRPD QIPEANTDFI       360
     AAVIGEELGL VGLTAVLLLY TVFALRGLRN ALAVRDTFGK LLGGGLAFAV AFQVFIIIGG       420
     VMKLIPMTGI TAPFLSKGGS SLLANYVLVA LLLRISDAAR SPQAPVKPRV QQPAIADQFT       480
     VMVERPK                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page