(data stored in ACNUC7421 zone)

EMBL: CP001630.PE240

CP001630.PE240       Location/Qualifiers
FT   CDS             complement(269454..270344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0245"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   rec:RHECIAT_PC0000780 putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34214"
FT                   /db_xref="GOA:C6WF82"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF82"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACU34214.1"
FT                   /translation="MTVVAERLRVGLVGAGPWARAVHAPGLAAHPGVELVSVWGRRHDV
FT                   AAGLAAEHGAAAVREVDELLEQVDAVAFAVPPGVQAPIAVTAARRGRHLVLEKPVAESV
FT                   AGARELVDAVDEAGVAALVMLTRRFAPETREQLVDWRDLGGWTGGAARWVGGGLLGGPY
FT                   SASPWRHERGALDDVGPHAFDLLDAALGRITGVRAASCAGGLWQVLLEHESGAVSSAAL
FT                   GMSVPVSPGVAELEVFGAHGRRVLAGRGSTARDCYAVLLDDLVGAVASGAVRHPCDVRR
FT                   GLHLQRVIAEVRALA"
     MTVVAERLRV GLVGAGPWAR AVHAPGLAAH PGVELVSVWG RRHDVAAGLA AEHGAAAVRE        60
     VDELLEQVDA VAFAVPPGVQ APIAVTAARR GRHLVLEKPV AESVAGAREL VDAVDEAGVA       120
     ALVMLTRRFA PETREQLVDW RDLGGWTGGA ARWVGGGLLG GPYSASPWRH ERGALDDVGP       180
     HAFDLLDAAL GRITGVRAAS CAGGLWQVLL EHESGAVSSA ALGMSVPVSP GVAELEVFGA       240
     HGRRVLAGRG STARDCYAVL LDDLVGAVAS GAVRHPCDVR RGLHLQRVIA EVRALA           296
//

If you have problems or comments...

PBIL Back to PBIL home page