(data stored in ACNUC7421 zone)

EMBL: CP001630.PE242

CP001630.PE242       Location/Qualifiers
FT   CDS             270739..271578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0247"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rpd:RPD_3111 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34216"
FT                   /db_xref="GOA:C6WF84"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF84"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACU34216.1"
FT                   /translation="MSRGVIGRTLAVVRELPEELVLPPGALPATTPDPPAPTRDAASVL
FT                   LVRDGERGLEVFLQRRVLGMAFAGGMTVFPGGGVDPRDADTSVEWAGPPPSWWAGRFGC
FT                   GEEVARALVCAAVRETFEESGVLLAGPSASEVVADASAYFAERRALERRELSLAAFLAG
FT                   ARLVLRADLLRPWANWVTPVEEPRRYDTRFFTAALPDGQLADGVTSEASDAVWQRPSEA
FT                   IADWEEGRRLLLPPTWVALADLAELGSVAEALAVEREVDRVIPKLVRDGDVVRVVLP"
     MSRGVIGRTL AVVRELPEEL VLPPGALPAT TPDPPAPTRD AASVLLVRDG ERGLEVFLQR        60
     RVLGMAFAGG MTVFPGGGVD PRDADTSVEW AGPPPSWWAG RFGCGEEVAR ALVCAAVRET       120
     FEESGVLLAG PSASEVVADA SAYFAERRAL ERRELSLAAF LAGARLVLRA DLLRPWANWV       180
     TPVEEPRRYD TRFFTAALPD GQLADGVTSE ASDAVWQRPS EAIADWEEGR RLLLPPTWVA       240
     LADLAELGSV AEALAVEREV DRVIPKLVRD GDVVRVVLP                              279
//

If you have problems or comments...

PBIL Back to PBIL home page