(data stored in ACNUC7421 zone)

EMBL: CP001630.PE243

CP001630.PE243       Location/Qualifiers
FT   CDS             271575..272375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0248"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   aav:Aave_0793 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34217"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF85"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACU34217.1"
FT                   /translation="MSGRPAEGERFEHPAYGVLRPVTPEAAVLLADNPSVMTLDGTNTW
FT                   VLRAPGEESCVVVDPGPSDEAHLARAAGFGPVAQVLLTHGHPDHAEGAREFGERVGAPV
FT                   RALDPALRLGGEGLAHGDVVAAAGLEIRVVGTPGHTSDSLCFLVGGAVLTGDTILGRGT
FT                   TIVAHPDGRLGDYLESLRVLADLPPGTTVLPGHGPELPDAAEAARRYLAHREQRLAQVA
FT                   AALEALGPDATARQVVESVYADVDRALWPAAEWSVRAQLEHLRR"
     MSGRPAEGER FEHPAYGVLR PVTPEAAVLL ADNPSVMTLD GTNTWVLRAP GEESCVVVDP        60
     GPSDEAHLAR AAGFGPVAQV LLTHGHPDHA EGAREFGERV GAPVRALDPA LRLGGEGLAH       120
     GDVVAAAGLE IRVVGTPGHT SDSLCFLVGG AVLTGDTILG RGTTIVAHPD GRLGDYLESL       180
     RVLADLPPGT TVLPGHGPEL PDAAEAARRY LAHREQRLAQ VAAALEALGP DATARQVVES       240
     VYADVDRALW PAAEWSVRAQ LEHLRR                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page