(data stored in ACNUC7421 zone)

EMBL: CP001630.PE244

CP001630.PE244       Location/Qualifiers
FT   CDS             272493..273131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr3017 5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34218"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34218.1"
FT                   /translation="MTNKRALLTALTATTLALAGCTTLEPGRPVAAPGASAPASTSAKP
FT                   STSAKPSASGKPSASNAALTEIDVCGRVPADLMPTLVPQMVGKPGEATCAQEPTELNKA
FT                   GYPTQEGQFKVDGKVVMAIVVTVYQGALDMQGYVKFQLDQNPGKVSAYDVMSLPGYSGQ
FT                   SNFKDLKFVMGAAAGVNGDMHTGQVLLEQQPDELGMSATAFLLKMTIDD"
     MTNKRALLTA LTATTLALAG CTTLEPGRPV AAPGASAPAS TSAKPSTSAK PSASGKPSAS        60
     NAALTEIDVC GRVPADLMPT LVPQMVGKPG EATCAQEPTE LNKAGYPTQE GQFKVDGKVV       120
     MAIVVTVYQG ALDMQGYVKF QLDQNPGKVS AYDVMSLPGY SGQSNFKDLK FVMGAAAGVN       180
     GDMHTGQVLL EQQPDELGMS ATAFLLKMTI DD                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page