(data stored in ACNUC7421 zone)

EMBL: CP001630.PE246

CP001630.PE246       Location/Qualifiers
FT   CDS             complement(273605..274702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0251"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sus:Acid_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain; SMART: DNA polymerase III
FT                   beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34220"
FT                   /db_xref="GOA:C6WF88"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF88"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACU34220.1"
FT                   /translation="MDLTATTSELASAVADVARLLPGRVLDPVLAGVVLRAGPGGVELS
FT                   GSDRERSLRLSRAATTHSEGAALVPAKPLAETLRALESPQVRLVVEGSRLAVRTGAARF
FT                   ALPLLELGDHPGVPELPPVAGSAPAGAFASALAAVATAASKDDALPVFTGVRVHAAGDR
FT                   LELITSDRYRLGFASVPWAGGALDALAPAVQLAEVAKQAARDERVELRADADRLALAWG
FT                   GGSASTALLAAPFPDERARKLLAAEGECTVVLEADELAGAVRRAAPYSGAHGAVQLAAE
FT                   DGELRVRGSDPQAGESSESVKASVSGGLLTRSFQVRYLSDALRAFAGRRVELRVQSGLR
FT                   STVLTAEEDTSGVRLTYLVVPLRTP"
     MDLTATTSEL ASAVADVARL LPGRVLDPVL AGVVLRAGPG GVELSGSDRE RSLRLSRAAT        60
     THSEGAALVP AKPLAETLRA LESPQVRLVV EGSRLAVRTG AARFALPLLE LGDHPGVPEL       120
     PPVAGSAPAG AFASALAAVA TAASKDDALP VFTGVRVHAA GDRLELITSD RYRLGFASVP       180
     WAGGALDALA PAVQLAEVAK QAARDERVEL RADADRLALA WGGGSASTAL LAAPFPDERA       240
     RKLLAAEGEC TVVLEADELA GAVRRAAPYS GAHGAVQLAA EDGELRVRGS DPQAGESSES       300
     VKASVSGGLL TRSFQVRYLS DALRAFAGRR VELRVQSGLR STVLTAEEDT SGVRLTYLVV       360
     PLRTP                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page