(data stored in ACNUC7421 zone)

EMBL: CP001630.PE247

CP001630.PE247       Location/Qualifiers
FT   CDS             complement(274744..276042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0252"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sml:Smlt0548 putative MFS family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34221"
FT                   /db_xref="GOA:C6WF89"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF89"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34221.1"
FT                   /translation="MVLAYQVCILARMSHSARLSDYRAALTTPAMRGPVVAGLFARLPI
FT                   AMIGFALLLYVQRASGSYGTAGLVSASALIGVALGAIAQGRLMDRFGPSRPLLAVTALF
FT                   ALAATGAVVAVESGVAVVVLAPLAFAVGFTEPMAGSASRALWTSIVPAGPLRDAGIAYE
FT                   AISMEVFFILGPGLAGVLVTAAWPGTGFVVGAAMMVVGALWFACTPTVRGRRPEPVQGG
FT                   GPLGALASPGMRTVALAALGFGLSIGFIEVAVPAAADAAGHKGVGGLLLSLWSVSSVLF
FT                   GVLYSLRPLPRPMHLRLPVLLGGFSLLAALLAIPTTLVGLAVALFVVGSLITPQSTAHS
FT                   AAIEQVAPEGTAAEAFGWVVTAVTLGLAAGQGLAGQIVEARGTSTAFLAAAASGLAVAV
FT                   VVWLLRGTVAAGAPGVPAGAAVPQEEEAGLVGR"
     MVLAYQVCIL ARMSHSARLS DYRAALTTPA MRGPVVAGLF ARLPIAMIGF ALLLYVQRAS        60
     GSYGTAGLVS ASALIGVALG AIAQGRLMDR FGPSRPLLAV TALFALAATG AVVAVESGVA       120
     VVVLAPLAFA VGFTEPMAGS ASRALWTSIV PAGPLRDAGI AYEAISMEVF FILGPGLAGV       180
     LVTAAWPGTG FVVGAAMMVV GALWFACTPT VRGRRPEPVQ GGGPLGALAS PGMRTVALAA       240
     LGFGLSIGFI EVAVPAAADA AGHKGVGGLL LSLWSVSSVL FGVLYSLRPL PRPMHLRLPV       300
     LLGGFSLLAA LLAIPTTLVG LAVALFVVGS LITPQSTAHS AAIEQVAPEG TAAEAFGWVV       360
     TAVTLGLAAG QGLAGQIVEA RGTSTAFLAA AASGLAVAVV VWLLRGTVAA GAPGVPAGAA       420
     VPQEEEAGLV GR                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page