(data stored in ACNUC7421 zone)

EMBL: CP001630.PE248

CP001630.PE248       Location/Qualifiers
FT   CDS             complement(276747..277421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0253"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: bbt:BBta_5745 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34222"
FT                   /db_xref="GOA:C6WF90"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF90"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACU34222.1"
FT                   /translation="MDETLARAGIFQGVEPAAAEALAQTLESVEFPRGHVIFAEGEPGD
FT                   RLYIIQSGKVKIGRKSPDGRENLLGIFGPSDMFGELSIFDPGPRTSTATTVTEVRAVSM
FT                   DRPALRQWISNRPEIAEQLLRALARRLRRTNSMLADLIFTDVPGRVAKALLQLAQRFGS
FT                   QEAGLLRVTHDLTQEEIAQFVGASRETVNKALADFAHRGWLRLEGKSVLILDPERLARR
FT                   AR"
     MDETLARAGI FQGVEPAAAE ALAQTLESVE FPRGHVIFAE GEPGDRLYII QSGKVKIGRK        60
     SPDGRENLLG IFGPSDMFGE LSIFDPGPRT STATTVTEVR AVSMDRPALR QWISNRPEIA       120
     EQLLRALARR LRRTNSMLAD LIFTDVPGRV AKALLQLAQR FGSQEAGLLR VTHDLTQEEI       180
     AQFVGASRET VNKALADFAH RGWLRLEGKS VLILDPERLA RRAR                        224
//

If you have problems or comments...

PBIL Back to PBIL home page