(data stored in ACNUC7421 zone)

EMBL: CP001630.PE25

CP001630.PE25        Location/Qualifiers
FT   CDS             complement(27955..29379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0025"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C-like; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: tgr:Tgr7_0952 protein
FT                   phosphatase 2C-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33999"
FT                   /db_xref="GOA:C6WCH8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH8"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ACU33999.1"
FT                   /translation="MTLVLRYAARSDRGLVRQNNQDSVYAGPRLLALADGMGGHAAGEV
FT                   ASKVVIAALAPLDDDEPGDDLLGQLRDAVISGNGAISELVQSDPDLDGMGTTLTAVLFA
FT                   GTRLGMVHIGDSRAYMMRNGTFSQITHDDTFVQSLIDEGRITEEEAATHPQRSLLLRAL
FT                   TGHEVEPRLMVREARPGDRYLLCSDGLSGVVTLETLDEAIRIPDPQACADRMIELALKG
FT                   GGPDNVTVVVADVVDVDFGENAPIVGGAAGDGGDDPPPPDSPASRASSITGPRPAPPRQ
FT                   EQPPPPQQDPKRERKGKLKALALVVLVLALLAAAGLGTRWWVMRQYYVGAAQDGQVSVF
FT                   RGVTGNVLGFELNTVVEGSCPPGSQGCEPISLDDLKVFMRDEVSSGITAVDGLEGAREA
FT                   IRRLRTEQLLPLCADPLTSTPAPPTTTTGSATSAEQPPPSGDQGTSSSAPPTTTTEGTP
FT                   LPTLAQTPGTDCRKGQ"
     MTLVLRYAAR SDRGLVRQNN QDSVYAGPRL LALADGMGGH AAGEVASKVV IAALAPLDDD        60
     EPGDDLLGQL RDAVISGNGA ISELVQSDPD LDGMGTTLTA VLFAGTRLGM VHIGDSRAYM       120
     MRNGTFSQIT HDDTFVQSLI DEGRITEEEA ATHPQRSLLL RALTGHEVEP RLMVREARPG       180
     DRYLLCSDGL SGVVTLETLD EAIRIPDPQA CADRMIELAL KGGGPDNVTV VVADVVDVDF       240
     GENAPIVGGA AGDGGDDPPP PDSPASRASS ITGPRPAPPR QEQPPPPQQD PKRERKGKLK       300
     ALALVVLVLA LLAAAGLGTR WWVMRQYYVG AAQDGQVSVF RGVTGNVLGF ELNTVVEGSC       360
     PPGSQGCEPI SLDDLKVFMR DEVSSGITAV DGLEGAREAI RRLRTEQLLP LCADPLTSTP       420
     APPTTTTGSA TSAEQPPPSG DQGTSSSAPP TTTTEGTPLP TLAQTPGTDC RKGQ             474
//

If you have problems or comments...

PBIL Back to PBIL home page