(data stored in ACNUC7421 zone)

EMBL: CP001630.PE250

CP001630.PE250       Location/Qualifiers
FT   CDS             278144..278917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0255"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: pca:Pcar_0009 endonuclease III; TIGRFAM:
FT                   endonuclease III; PFAM: HhH-GPD family protein;
FT                   helix-hairpin-helix motif; SMART: HhH-GPD family protein;
FT                   iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34224"
FT                   /db_xref="GOA:C6WF92"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF92"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ACU34224.1"
FT                   /translation="MVGGARGGARPETRLGLVRRARRTVRVLGVGYPDAHCELDFTTPL
FT                   ELLVAVVLSAQCTDKRVNQVTPALFARYRSAEEYAAADRTELEELVRPTGFYRNKAAAI
FT                   SGLAAEIVERHDGEVPGTQAELVKLPGVGRKTANVVLGDAFGVPGITVDTHFGRLVRRW
FT                   GWTTEEDPVKVEHAVGALVERKDWTLLSHRTIFHGRRVCHARTPACGACLLAPQCPSFG
FT                   TGPTDPVRAAKLVKGDEAEHLIGLAERVRAGERLG"
     MVGGARGGAR PETRLGLVRR ARRTVRVLGV GYPDAHCELD FTTPLELLVA VVLSAQCTDK        60
     RVNQVTPALF ARYRSAEEYA AADRTELEEL VRPTGFYRNK AAAISGLAAE IVERHDGEVP       120
     GTQAELVKLP GVGRKTANVV LGDAFGVPGI TVDTHFGRLV RRWGWTTEED PVKVEHAVGA       180
     LVERKDWTLL SHRTIFHGRR VCHARTPACG ACLLAPQCPS FGTGPTDPVR AAKLVKGDEA       240
     EHLIGLAERV RAGERLG                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page