(data stored in ACNUC7421 zone)

EMBL: CP001630.PE251

CP001630.PE251       Location/Qualifiers
FT   CDS             278914..279594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0256"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   xop:PXO_04554 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34225"
FT                   /db_xref="GOA:C6WF93"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF93"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACU34225.1"
FT                   /translation="MSAAARWSVVVLVLAVAGVVALWPRGEDPASPVIPQPQRDTSQRA
FT                   DLGVARNKAALRPCDQFSGNSASPASANAASPSPASPSAGPTSTSAGPEALRGATAVCL
FT                   GDGERVDAATALSGRVLVNFWASWCAPCREELRVLDDYSQRPGAIPVLGVQVKSGEADG
FT                   LDLLSRIGVHLPSLVDDSEALLRAFKVPPTLPASFLVGADGSITPVTDPLVFTSVDQVR
FT                   EVVG"
     MSAAARWSVV VLVLAVAGVV ALWPRGEDPA SPVIPQPQRD TSQRADLGVA RNKAALRPCD        60
     QFSGNSASPA SANAASPSPA SPSAGPTSTS AGPEALRGAT AVCLGDGERV DAATALSGRV       120
     LVNFWASWCA PCREELRVLD DYSQRPGAIP VLGVQVKSGE ADGLDLLSRI GVHLPSLVDD       180
     SEALLRAFKV PPTLPASFLV GADGSITPVT DPLVFTSVDQ VREVVG                      226
//

If you have problems or comments...

PBIL Back to PBIL home page