(data stored in ACNUC7421 zone)

EMBL: CP001630.PE252

CP001630.PE252       Location/Qualifiers
FT   CDS             279591..280331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0257"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mch:Mchl_1739 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34226"
FT                   /db_xref="GOA:C6WF94"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF94"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACU34226.1"
FT                   /translation="MTDRTTDPVTGHDADRAAGLAPGGAPERLVDDLGELPEWMRGLAA
FT                   AAVDADADTFLNYPKPPAFTGRAASVLMLFGEGHRGPDLLLLRRADTLGSHPGQVAFPG
FT                   GAADPEDSGPVGTALREAFEETGVLAEGVRPVALLPELHVPVSGFLVTPVLAHWRTPVP
FT                   VAPVDPGETAAVARIPVAHLADPANRFRVSHPSGYTGPAFSAPGMLVWGFTAGLVSGLL
FT                   RLGGWERPWDATDVRDLDSALRAT"
     MTDRTTDPVT GHDADRAAGL APGGAPERLV DDLGELPEWM RGLAAAAVDA DADTFLNYPK        60
     PPAFTGRAAS VLMLFGEGHR GPDLLLLRRA DTLGSHPGQV AFPGGAADPE DSGPVGTALR       120
     EAFEETGVLA EGVRPVALLP ELHVPVSGFL VTPVLAHWRT PVPVAPVDPG ETAAVARIPV       180
     AHLADPANRF RVSHPSGYTG PAFSAPGMLV WGFTAGLVSG LLRLGGWERP WDATDVRDLD       240
     SALRAT                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page