(data stored in ACNUC7421 zone)

EMBL: CP001630.PE253

CP001630.PE253       Location/Qualifiers
FT   CDS             280353..281540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0258"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein; peptidase S1 and
FT                   S6 chymotrypsin/Hap; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34227"
FT                   /db_xref="GOA:C6WF95"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF95"
FT                   /inference="protein motif:PFAM:PF02674"
FT                   /protein_id="ACU34227.1"
FT                   /translation="MNWVDLLVLAIAAFAAVSGARQGMVVAVPAFIGVLVGLLLGTQLA
FT                   PVVVSRFDNVVTKVVFAVGVVVLLVALGETLGVYIGRAVKSKVNATPLRGVDNALGAVV
FT                   QGAVVFVVAWMIALPLTSVAGLPTLAKGLNQSAILSTVDGAMPQAARDLSEDLQNLFDV
FT                   SGFPAAMDPFNRTPLREVSPPDPELSGDPVVQRLRPSVLKVRGRAPSCSRALEGTGFVI
FT                   APERVMTNAHVVAGTTEVSIEVGQGKFDATVVHYDAQTDLAILAVPNLDAQPLQFRTDE
FT                   IDQGEDGIVLGYPLDGPYTASEARVRERIPMLRGPDIYDAQTVTRDVYTIRAKVRSGNS
FT                   GGPLVDREGRVMGVVFGAAVDDQETGFVLTPQEVADEVAKAPGLVRRAPTQTCAS"
     MNWVDLLVLA IAAFAAVSGA RQGMVVAVPA FIGVLVGLLL GTQLAPVVVS RFDNVVTKVV        60
     FAVGVVVLLV ALGETLGVYI GRAVKSKVNA TPLRGVDNAL GAVVQGAVVF VVAWMIALPL       120
     TSVAGLPTLA KGLNQSAILS TVDGAMPQAA RDLSEDLQNL FDVSGFPAAM DPFNRTPLRE       180
     VSPPDPELSG DPVVQRLRPS VLKVRGRAPS CSRALEGTGF VIAPERVMTN AHVVAGTTEV       240
     SIEVGQGKFD ATVVHYDAQT DLAILAVPNL DAQPLQFRTD EIDQGEDGIV LGYPLDGPYT       300
     ASEARVRERI PMLRGPDIYD AQTVTRDVYT IRAKVRSGNS GGPLVDREGR VMGVVFGAAV       360
     DDQETGFVLT PQEVADEVAK APGLVRRAPT QTCAS                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page