(data stored in ACNUC7421 zone)

EMBL: CP001630.PE254

CP001630.PE254       Location/Qualifiers
FT   CDS             complement(281588..282514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0259"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   acp:A2cp1_0551 alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34228"
FT                   /db_xref="GOA:C6WF96"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF96"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU34228.1"
FT                   /translation="MAPPPDPSSARIPGPWAHRDVSANGIRLHVAELGDGPLVLLLHGF
FT                   PEFWWSWRHQLVDLAEAGYRAVAVDLRGYGDSDKPPRGYDGFTLAGDVAGLVKALGEPR
FT                   AHVVGHAWGGMLAWVVGALHPRLVRSVTAVSAPHPLALRRAVRRNTAGQARALGHLLRF
FT                   QLPVLPERSLLAANGARVGELLRAWGGAGWTASPEFAEVVERNTAAVRIPGVAHSALEY
FT                   HRWAVRSQVRSDGRRFVEAVSRKLEAPVLQVQGARDPVMLAQTALDSARWRGPDSVLRV
FT                   LQDVGHFPHQEDRAEVSRVIAGFLAER"
     MAPPPDPSSA RIPGPWAHRD VSANGIRLHV AELGDGPLVL LLHGFPEFWW SWRHQLVDLA        60
     EAGYRAVAVD LRGYGDSDKP PRGYDGFTLA GDVAGLVKAL GEPRAHVVGH AWGGMLAWVV       120
     GALHPRLVRS VTAVSAPHPL ALRRAVRRNT AGQARALGHL LRFQLPVLPE RSLLAANGAR       180
     VGELLRAWGG AGWTASPEFA EVVERNTAAV RIPGVAHSAL EYHRWAVRSQ VRSDGRRFVE       240
     AVSRKLEAPV LQVQGARDPV MLAQTALDSA RWRGPDSVLR VLQDVGHFPH QEDRAEVSRV       300
     IAGFLAER                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page