(data stored in ACNUC7421 zone)

EMBL: CP001630.PE255

CP001630.PE255       Location/Qualifiers
FT   CDS             complement(282523..282990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0260"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   mpo:Mpop_1689 protein of unknown function DUF1469"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34229"
FT                   /db_xref="GOA:C6WF97"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF97"
FT                   /inference="protein motif:PFAM:PF07332"
FT                   /protein_id="ACU34229.1"
FT                   /translation="MTTPSENTPPPIPSIPLTAENASTIAGETSIGGLVRDATAHVSTL
FT                   LRAEVELAKAEVTHEVKRGLKGSVFFILALVVLSFSLFFFFMFVAELIAVWLPVWAGYL
FT                   IVFGLMIGITVLLGLLGYRKMKTLRAPTRTIESAKETVAVLRRRDDQDDTP"
     MTTPSENTPP PIPSIPLTAE NASTIAGETS IGGLVRDATA HVSTLLRAEV ELAKAEVTHE        60
     VKRGLKGSVF FILALVVLSF SLFFFFMFVA ELIAVWLPVW AGYLIVFGLM IGITVLLGLL       120
     GYRKMKTLRA PTRTIESAKE TVAVLRRRDD QDDTP                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page