(data stored in ACNUC7421 zone)

EMBL: CP001630.PE256

CP001630.PE256       Location/Qualifiers
FT   CDS             complement(283062..284234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0261"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="TIGRFAM: Na+/H+ antiporter NhaA; PFAM: Na+/H+
FT                   antiporter NhaA; sodium/hydrogen exchanger; KEGG:
FT                   mlo:mlr5309 Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34230"
FT                   /db_xref="GOA:C6WF98"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF98"
FT                   /inference="protein motif:TFAM:TIGR00773"
FT                   /protein_id="ACU34230.1"
FT                   /translation="MSSPARKPAADFARYLRTETTGGIVLLVATAIALLWANSPLGDSY
FT                   TALRETHLGPLTIGDWVKDGLLAVFFFVAGLELKRELVVGELNSLKAAALPVIAAVGGM
FT                   VVPALVALGFSWGEPGAGQAWAIPMATDIAFALGVLAIAGSALPSSVRVFLLSLAVVDD
FT                   LGAIAVIAVLFTSGLELLAVLAAVALLALYAFLQHKRVTATWLYVPIAVGAWVAVHEAG
FT                   VHATIAGVALGLLTRVRADEGEDEAPAARLEHRLQPWSAGLVVPLFALFAAGVPIGGDA
FT                   LRALVDDPIALGVVAGLVLGKVIGILGFSALAVRLRLAVWPSGAGPRDVAAVGVLGGVG
FT                   FTVSLLIADLALAGEAAERAKAAVLIASLLASLIAAVLLVRRGRAHRDSD"
     MSSPARKPAA DFARYLRTET TGGIVLLVAT AIALLWANSP LGDSYTALRE THLGPLTIGD        60
     WVKDGLLAVF FFVAGLELKR ELVVGELNSL KAAALPVIAA VGGMVVPALV ALGFSWGEPG       120
     AGQAWAIPMA TDIAFALGVL AIAGSALPSS VRVFLLSLAV VDDLGAIAVI AVLFTSGLEL       180
     LAVLAAVALL ALYAFLQHKR VTATWLYVPI AVGAWVAVHE AGVHATIAGV ALGLLTRVRA       240
     DEGEDEAPAA RLEHRLQPWS AGLVVPLFAL FAAGVPIGGD ALRALVDDPI ALGVVAGLVL       300
     GKVIGILGFS ALAVRLRLAV WPSGAGPRDV AAVGVLGGVG FTVSLLIADL ALAGEAAERA       360
     KAAVLIASLL ASLIAAVLLV RRGRAHRDSD                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page