(data stored in ACNUC7421 zone)

EMBL: CP001630.PE257

CP001630.PE257       Location/Qualifiers
FT   CDS             complement(284370..286355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0262"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: aba:Acid345_3520
FT                   acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34231"
FT                   /db_xref="GOA:C6WF99"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF99"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ACU34231.1"
FT                   /translation="MTKPNENGPTLDNLLTESRTFPPSEEFAAQANATQALYDSAAADR
FT                   EAFWAEQADRLTWERKWDRVLDWSDAPFAKWFVGGRLNVAYNCVDRHVESGHGEQVAIH
FT                   WEGEPGDSRTITYADLKRDVSKAANALASLGVGAEDRVAIYMPMVPEAIVAMLACARIG
FT                   ALHSVVFGGFSAEALRTRVEDSQAKLVITTDGQYRRGNPAPLKPAVDEAVSKAASVEHV
FT                   LVVRRTGGEVAWTEGRDLWWHELVDGQSEEHAPEAFDSEHPLFILYTSGTTGNPKGILH
FT                   TSGGYLTQTAYTHHNVFDLKPDSDVYWCTADIGWVTGHSYIVYGPLANRVTQVVYEGTP
FT                   NTPHEGRHWEIVQKYGVSIYYTAPTLIRTFMKWGAEIPAKHDLSSLRVLGSVGEPINPE
FT                   AWIWYRENIGAGKAPIVDTWWQTETGAIMISPLPGVVSTKPGSAQRPLPGVGAKVVDDQ
FT                   GVEVGPGGGGYLVLDEPWPSMLRGIWGDDARYRDTYWSRFAEEGFYFAGDGAKYDADGD
FT                   IWLLGRVDDVMNVSGHRISTTEVESALVSHPTVAEAAVVGATDPTTGQGIVAFVILRGG
FT                   VAAGSDGAEAIKALRDHVAKEIGPIAKPRQIMVVPELPKTRSGKIMRRLLRDVAENRQV
FT                   GDVTTLADSSVMDLISSGLKKGSGED"
     MTKPNENGPT LDNLLTESRT FPPSEEFAAQ ANATQALYDS AAADREAFWA EQADRLTWER        60
     KWDRVLDWSD APFAKWFVGG RLNVAYNCVD RHVESGHGEQ VAIHWEGEPG DSRTITYADL       120
     KRDVSKAANA LASLGVGAED RVAIYMPMVP EAIVAMLACA RIGALHSVVF GGFSAEALRT       180
     RVEDSQAKLV ITTDGQYRRG NPAPLKPAVD EAVSKAASVE HVLVVRRTGG EVAWTEGRDL       240
     WWHELVDGQS EEHAPEAFDS EHPLFILYTS GTTGNPKGIL HTSGGYLTQT AYTHHNVFDL       300
     KPDSDVYWCT ADIGWVTGHS YIVYGPLANR VTQVVYEGTP NTPHEGRHWE IVQKYGVSIY       360
     YTAPTLIRTF MKWGAEIPAK HDLSSLRVLG SVGEPINPEA WIWYRENIGA GKAPIVDTWW       420
     QTETGAIMIS PLPGVVSTKP GSAQRPLPGV GAKVVDDQGV EVGPGGGGYL VLDEPWPSML       480
     RGIWGDDARY RDTYWSRFAE EGFYFAGDGA KYDADGDIWL LGRVDDVMNV SGHRISTTEV       540
     ESALVSHPTV AEAAVVGATD PTTGQGIVAF VILRGGVAAG SDGAEAIKAL RDHVAKEIGP       600
     IAKPRQIMVV PELPKTRSGK IMRRLLRDVA ENRQVGDVTT LADSSVMDLI SSGLKKGSGE       660
     D                                                                       661
//

If you have problems or comments...

PBIL Back to PBIL home page