(data stored in ACNUC7421 zone)

EMBL: CP001630.PE258

CP001630.PE258       Location/Qualifiers
FT   CDS             complement(286579..287160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0263"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   aav:Aave_3953 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34232"
FT                   /db_xref="GOA:C6WFA0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU34232.1"
FT                   /translation="MTWFDRPVLSDPHVRLEPLTPDHAPGLLKAGADPGVWTWLSSRQP
FT                   TDLPAMAAFVDRALTDPDRAPWAQVDPATGEVVGTTSYYEVDPEHRNLCIGHTWIGAPW
FT                   QRTPLNTAAKLLLLTRAFDGLGALRVGWHTDIRNERSQRAIARLGATREGVLRAHRIRP
FT                   DGTVRDTVVFSVTAPEWPGVRDRLVARLAE"
     MTWFDRPVLS DPHVRLEPLT PDHAPGLLKA GADPGVWTWL SSRQPTDLPA MAAFVDRALT        60
     DPDRAPWAQV DPATGEVVGT TSYYEVDPEH RNLCIGHTWI GAPWQRTPLN TAAKLLLLTR       120
     AFDGLGALRV GWHTDIRNER SQRAIARLGA TREGVLRAHR IRPDGTVRDT VVFSVTAPEW       180
     PGVRDRLVAR LAE                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page