(data stored in ACNUC7421 zone)

EMBL: CP001630.PE259

CP001630.PE259       Location/Qualifiers
FT   CDS             287252..287974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6904 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34233"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34233.1"
FT                   /translation="MTDPLAPLLDLPGVADAVASARDAVFRVHRHRVNLRGWATTAAEA
FT                   SVRAARASAALDGGPTTIPEDGEVTDPVLAGALRVAESLGVVFPTWQRAPLQALAKLHV
FT                   LAAADLGTELGRPRLVPGVAERLDLLAGLVTGGTSAPGPLVVAVVHGELMALTPFDTAN
FT                   GVVARAASRLASIATGLDPKSLGVPEVWCLRRRSEYDAALHGFSTGEPEGVARWITFSC
FT                   AALEAGAREAQGIADAAA"
     MTDPLAPLLD LPGVADAVAS ARDAVFRVHR HRVNLRGWAT TAAEASVRAA RASAALDGGP        60
     TTIPEDGEVT DPVLAGALRV AESLGVVFPT WQRAPLQALA KLHVLAAADL GTELGRPRLV       120
     PGVAERLDLL AGLVTGGTSA PGPLVVAVVH GELMALTPFD TANGVVARAA SRLASIATGL       180
     DPKSLGVPEV WCLRRRSEYD AALHGFSTGE PEGVARWITF SCAALEAGAR EAQGIADAAA       240
//

If you have problems or comments...

PBIL Back to PBIL home page