(data stored in ACNUC7421 zone)

EMBL: CP001630.PE26

CP001630.PE26        Location/Qualifiers
FT   CDS             complement(29376..29840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0026"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: mxa:MXAN_4649 FHA domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34000"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH9"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACU34000.1"
FT                   /translation="MPELVMQLTRAGFLILLWLFVLAALRVVRSDLYAASGLRVPTPSI
FT                   KKGFRGAGKGGAKAPRQLVVTQGALSGTRITLDGKPIMIGRADDSTLVLDDDFASTRHA
FT                   RLSARGDEWFVEDLGSTNGTYLDRAKVTSPVRVPIGSQIRIGKTVIELRS"
     MPELVMQLTR AGFLILLWLF VLAALRVVRS DLYAASGLRV PTPSIKKGFR GAGKGGAKAP        60
     RQLVVTQGAL SGTRITLDGK PIMIGRADDS TLVLDDDFAS TRHARLSARG DEWFVEDLGS       120
     TNGTYLDRAK VTSPVRVPIG SQIRIGKTVI ELRS                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page