(data stored in ACNUC7421 zone)

EMBL: CP001630.PE260

CP001630.PE260       Location/Qualifiers
FT   CDS             complement(287971..289092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0265"
FT                   /product="kynureninase"
FT                   /note="TIGRFAM: kynureninase; PFAM: aminotransferase class
FT                   V; KEGG: pde:Pden_2620 kynureninase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34234"
FT                   /db_xref="GOA:C6WFA2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA2"
FT                   /inference="protein motif:TFAM:TIGR01814"
FT                   /protein_id="ACU34234.1"
FT                   /translation="MTDPLAHVRELFDLADDVVYLDGNSLGAPPRAVAERLDDVVRRQW
FT                   GRRLIRSWSEGWWEAPQRVGDRIGRLVGAAPGQVVVGDSTSVNLFKALVGAVRGTDRSE
FT                   IVVDAGTFPTDGYIAGSAAELTGLSLRPADPDDLRLDERTAVVLLNHVDYRTGRLLDMA
FT                   GLTERAHEVGAKVVWDLCHSVGVLPIELDALGVDLAVGCTYKFLNGGPGSPAFLYVPSA
FT                   AQPGFRQPLTGWTGHREPFAMAAEYTPDAGIGRARAGTPDILSMLALDAALDVWDGVEL
FT                   ADVRAKGLALTARFMELVRDLPGIEVITPADGRRGHQVSLRHPEAARLMAELIAGGVIG
FT                   DHRPPDVLRFGFAPLYNTFDEAERAAKALEELL"
     MTDPLAHVRE LFDLADDVVY LDGNSLGAPP RAVAERLDDV VRRQWGRRLI RSWSEGWWEA        60
     PQRVGDRIGR LVGAAPGQVV VGDSTSVNLF KALVGAVRGT DRSEIVVDAG TFPTDGYIAG       120
     SAAELTGLSL RPADPDDLRL DERTAVVLLN HVDYRTGRLL DMAGLTERAH EVGAKVVWDL       180
     CHSVGVLPIE LDALGVDLAV GCTYKFLNGG PGSPAFLYVP SAAQPGFRQP LTGWTGHREP       240
     FAMAAEYTPD AGIGRARAGT PDILSMLALD AALDVWDGVE LADVRAKGLA LTARFMELVR       300
     DLPGIEVITP ADGRRGHQVS LRHPEAARLM AELIAGGVIG DHRPPDVLRF GFAPLYNTFD       360
     EAERAAKALE ELL                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page