(data stored in ACNUC7421 zone)

EMBL: CP001630.PE261

CP001630.PE261       Location/Qualifiers
FT   CDS             complement(289089..289910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0266"
FT                   /product="tryptophan 23-dioxygenase"
FT                   /note="PFAM: tryptophan 23-dioxygenase; KEGG: reh:H16_B1418
FT                   tryptophan 2,3-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34235"
FT                   /db_xref="GOA:C6WFA3"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA3"
FT                   /inference="protein motif:PFAM:PF03301"
FT                   /protein_id="ACU34235.1"
FT                   /translation="MEQVCPVAPKLDFGGTTPYEDYVRASVLHTLQRQASDDPREMSFL
FT                   VTTQVMELYFGLLCFEWRQAQKELRADDVTAAVRTLRRSELHMQALNAAWRPIARMTPG
FT                   EFNSFRDALGEGSGFQSGRYREVEFLLGEKSRSMLVPHRSAPAQHDALEALLSEPSLYD
FT                   DVLAALHRRGLDVPDELLKRDFAEAYAPDERVEAVWAHVYREGPRDLLELGEALTDVAE
FT                   EFSRWRHDHLLATRRSMGSKVGTGGSAGVAWLEKRVRRAVFPELWTARSYV"
     MEQVCPVAPK LDFGGTTPYE DYVRASVLHT LQRQASDDPR EMSFLVTTQV MELYFGLLCF        60
     EWRQAQKELR ADDVTAAVRT LRRSELHMQA LNAAWRPIAR MTPGEFNSFR DALGEGSGFQ       120
     SGRYREVEFL LGEKSRSMLV PHRSAPAQHD ALEALLSEPS LYDDVLAALH RRGLDVPDEL       180
     LKRDFAEAYA PDERVEAVWA HVYREGPRDL LELGEALTDV AEEFSRWRHD HLLATRRSMG       240
     SKVGTGGSAG VAWLEKRVRR AVFPELWTAR SYV                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page